TCDB is operated by the Saier Lab Bioinformatics Group
>XP_026106907.1 FXYD domain-containing ion transport regulator 5-like isoform X1 [Carassius auratus]
MNSKIILRGAAFFLLLVFRSFAAENVTETETPAPMTSPTPPFNNTEPTDEGKDNLKTTEVTMSPEEEDSNLTLTAANTED
STESPVPSSVTSKKTSAAHPTLNTTTSRIEAARPVKWDKKWDEPFNYNYSNLRHVGLTIAAVLFVMGIMVLGCGKVKRIP
RCHIGKGSSYEVTRS