TCDB is operated by the Saier Lab Bioinformatics Group
>XP_027195278.1 glutamate receptor ionotropic, kainate 2-like [Dermatophagoides pteronyssinus]
MSNHYHLGQSIVITHYNRKRRRQQQITNHIKSIRPNHFTTIKQQIWQWSLLMLMLFVSLEITIINVNGQQQQQQQQAYHV
PFANLQSLSSLVIGMQQQQPTFNIHHYPSSYLAPSVAKIGAIFHHQENFEHLSSSSSSSPLSASSLQSSIISSSSPSNIG
SKTSSSNLIQQQSSSASAATNAIFQSQSSIATNNNRPSPSILGSNNDNDEFEAEIAFRYAVKRINKDRNILPNTTLIYDI
EYISRDDSFHAAKKACKLIRDGAVAIFGPSDDRIGVHVQSVCDTLDIPHLETRKHNLNIGKEFSINLHPGAFAVAQSIRV
LITFLNWTRIAVIYEDDINLIGLQELTTLPLAKNVQFFFRKTQQDSFRETLMDLRDREIYTMVVDIPHEHLPSFFTAILQ
IQMNENRYHYHFTTFDLEIFDLEDFMYNEVNITAYRIVDYSNPMIRSMLKEMSKYYPDIARQLLHQNHLIKASSAMMFDS
VYAFARGLNQLSSSITMLNSFASCSNETAWNNGLTLYNYIDSLSFHGMTGPVMFKEGIRHNMRMELLKLRNFRLEKVGEF
FYSTSLLNITNMDAFLTSKQRNVTLRVTTVMMEPYIRQMRSSNKSFELKLLQAEKIRYEGYCIDLLNAISKNLGFTYELY
EVEDGRFGALDEQTGEWHGLVRELIDKRADLAIGPLTISYARENVIDFTKPYMNLGIGILFKMPTHAPTRLFSFMSPLAV
DIWLYVVAAYVLVSSTLFIVARFSPYEWINPHPCIPDSESIKINQFNLADSFWFTVVTLMKQGCDMNPKSMSTRIIGAIW
WFFTLILISSYTANLAAFLTVERITTPIESVEDLAHQSKIRYGTLRNSSTMSFFRDSKFPIYQKMWQFMEKHPENFAASY
EEGRKRVLMGDYAFLMESTMIDYMVQRDCNLVQIGGLLDSKGYGIATQMGSEWKDKISLSILGLQENGELQMIYDKWWKS
PGLTCTDELKNKDGKANPLGLGNIGGVFVVLLLGLVAAMISAMLEFMTHVKRINVRMDDVFTPDLILYDSIQPTNMMKKF
NNAELIITNDGTVHWSPLLRMQSICRLNIQDWPYDQQKCSLIFISWSYPIDALALYISTKSINVRDLWPNNEWEVIGTSC
DTLIVSDIPGRPDLFFPGVKYTISVRRRSTPYPYLIDAPIICTTIINIISIWLIDPFDPKRIRFQLNRLSFFIILITSFY
PSYILGLGMFGTTRLVKFLGSMMVSSAVLMLWSALSMNIIQSTKPNPITEQIWRNMTQRALNWRLIRFNHYNIHANDAND
DDDNGGDRQSSINEQRRRNYLFVILIDRVLLIIFLIIFFMFYKF