TCDB is operated by the Saier Lab Bioinformatics Group
>XP_027868562.1 uncharacterized protein LOC114141881 isoform X2 [Xiphophorus couchianus]
MSVTMTRNDGVTVFTVQSDPQSRWPPVCQILKSLCYSPLCCSLSPQVRKSQGMSFSVLGAIQIMIGLLNLGLGGTLRFSP
DTYRVLNYSGFPFWLGALFITFGLMCVLSEKFPSLCLVILNVILNLTGVGFAIAAIVLYSIYISHLNIWWWNCSTSRSYN
YDNTRTPPSQSESELFRQLCLEGNLVSQVLLIGMNVVLILLSIMELCVAISAVVLSIKTLRNSAQEEDTNVENTKPLLEE
VTCHSAA