TCDB is operated by the Saier Lab Bioinformatics Group
>XP_029997346.1 sorting nexin-8 isoform X1 [Sphaeramia orbicularis]
MTVRAMAGEINEGSVPAYYREVYEAIRCRTDERVQVEVFQRLLQRANLSKAALGKIAEHVESTDGFLTKLSLYKALALIA
LAQQGKQPSPKLLENCIQELPKPQLGEPSDLSTLRMQPAQEDVLTLSETLDRLLARDTVQVELIPEKKGLFLKHVEYQVT
SQHYKISVYRRYSDFDVFHEVLLQRYAYRMVPALPPKRMLKGVLTSVSEREFIEGRRRALARFINLVARHPFFSQDELVK
TFLTFSGSDVQTKLRDTYKKTGDEFMTNRTATLAKEYLPTDIQAQFSSSRELIRNIHNSFHKLRDRAEKMAERSKENATD
LLMFGRELSSLGSDASSIPSFASSQSTWGAMRQSLKSLSVEFAVLSDKAAQQGRREEDDVVEKLNVFLDLLQSYRDLCER
HEKGVLHEHQRALHKYGVMKRQMMSATVQPKEQASVEQLESRIVQQENAIQTMELRNYFSLFCLHQETQLIFTYLPITSH
ILGAFVNSQVQGHREMGEVWNELQPKLGCLFSGNNGMKSAF