TCDB is operated by the Saier Lab Bioinformatics Group
>XP_030066976.1 E3 ubiquitin-protein ligase RNF114 [Microcaecilia unicolor]
MAAEVSSPAGRAASADVPAPFTCPVCLEVFEKPIKVKCGHVFCTVCLQECLKPKIPVCGVCRSSLTPGIRALDLEKQIET
TETTCRGCNQKMYLSKMRVHAASCSKYQNYVMEGIKAATRDQPPHTRDVPNRYTFPCPYCSEKNFDQEGLVEHCRKCHSM
DTRQVVCPICAAMPWGDPNYMSANFMEHIHRRHRFSYDTFVDYDADEDAMMNEAVLRSLVDN