TCDB is operated by the Saier Lab Bioinformatics Group
>XP_030886315.1 phospholipase DDHD1 isoform X3 [Leptonychotes weddellii]
MRGQWFIDGTWQPLEEEESNLIEQEHLSCFRGQQMQENFDIEVSKSIDGKDGSGISYSAIHSFKLSRNHVDWHSMDEVYL
YSDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMDQGRIIKNTAMMREAARKIE
ERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCS
RNPDFEEKGGKVSIVSHSLGCVITYDIMTGWNPIRLYEQLLQKEEELPDERWMSYEERHLLDELYITKRRLREIEERLHG
LKASSMTQTPALKFKVENFFCMGSPLAVFLALRGIRPGNTGSQDHILPREICNRLLNIFHPTDPVAYRLEPLILKHYSNI
SPVQIHWYNTSNPLPYEYMKPSFLHPAKEPTSISENEGISTIPSPVTSPVLSRRHYGESITNIGKASILGAASIGKGLGG
MLFSRFGRSSTSQSSEASKDSIEDEKKPVALLPTTTVATQILPHSSSGFLDSAYFRLQESFFNLPQLLFPENVMQNKDNT
LVELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVALFLLTFMYKHEHDNNAKPNLDPI