TCDB is operated by the Saier Lab Bioinformatics Group
>XP_039697251.1 V-set domain-containing T-cell activation inhibitor 1 [Pteropus giganteus]
MASLGQIIFWSIISSIIVLAGAIALIIGFGISGTHSITVTTLTSAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVTGLV
HEFKEGKDDLSDQNEMFRGRTAVFADQVRVGNASLRLKNVRLTDAGTYKCYVLTANGKGNAGLEYKTGAFSIPEMDVDYN
ASSESFRCEAPRWFPQPTVVWTSQADLRANFSQVSNTSFELNSENVTMKVVSILYNVTINNTYSCMIENDLAKATGDIKV
TDSEIKRRSHLELLDSKVSLCVSSFFAVSWVLLSLSSSLMLK