TCDB is operated by the Saier Lab Bioinformatics Group
>XP_041576711.1 granulocyte colony-stimulating factor receptor isoform X1 [Taeniopygia guttata]
MARRGAGTPFLRQLSLLLLLHLGGTLGCASVAVSPRVVPLGSAVTASCTIQRELCHGLEQGKVRISWMLDNKLVAGSQHQ
GPGGTEVSNLTLPRFNLTQARLFCCVEWNGTKQRVGVAEIRAGYPPAKPLNLSCVLNLSDYGLTCRWEQGTNSHLPTSVV
LKCTGSGAQAVTGCTPRGGHSHCTVPRQLLQLYRQMEIWVSATNALGTAESERLCIDPMDVAKLDPPTLQSIQSIPFQTD
CIALAWDVAWGTEHMELQCELRYRAPEDSAWALVTGIIGQAGSAQRCGFLFGTQYCFQMRCRRSSATALASWSEWSPVRN
YTTHEKGESPAGKLDAWWGARPAGPGGRLEVQLRWKAPRQREANGRVLGYRVTLSPRRRGRDPPTLCNTTRTQCNFSVPA
ATGRVYLSAYNAAGEAAPTEVTLLERKGQPLAGLRAVPGGERSLWVHWEAPPAPVSAYVLEWQRVTAEPGHCSACWQMER
DGTATRALIQDGIEPFQRYNISLYPLYEGTVGVPVHTTAYSQQKAPSHAPKLHLKRISKSEAELCWEPLPVEVQNGFITS
YTIFWASSITSMASATVTPSLSSFAIRGLKPSTLYKVHIMASTAAGSTNGTSLTLVTTALDDTEIQFLFLSLGLVFVGLM
VLLICFQKNERMKEQLWPSVPDPANSSLGKWVPAAAPQEPLQVPAAREPGPAAISTVTVLEGDAGKEPGKEPGKEPPGTP
RPYVRQEGPGEPVQYARVGPAGYRGQRLLPEPAPRSYENLRGRGDGGGGDWGFLEEPPATFPLLQGLRIGGNEELHECRA
D