TCDB is operated by the Saier Lab Bioinformatics Group
>XP_723491.2 hypothetical protein CAALFM_C109430WA [Candida albicans SC5314]
MAVAPSSVSTSTIISTLLANLALFGVFVGCFIVLRLKFKRIYSPKSSFDLVPEEKKPEPLPKDPFRWIFILLTKPDSFFL
QQAGLDGLVFLRYIKTFGTLFLCALLMYIILLPVNATNGNHNKGFDQLSIANVKHPRRYYAHVLMGLVFNGIVIFVIYRE
LFFYNSLKNAVLSSPKYAKKLSCRTVLFQGVPDSLLDEKQAFKIFNGVKRVYVARTARELEYKVEKRAAMVTKLENAENK
LMKMAVKSKLKADKKGIILEPVDEISSYVSEKKRPKMKVGGFFSSKVDTIRHCQEQIPILDKEVKKLQKKFRHSMPLNSI
FVEFENQYYAQLAYQSTVHHNPMRMSPRFIGLEPKDVIHSNLRMFWWERITRRFLAFAAIVALVVFWAIPVAAVGTISNI
TFLTNKLPWLRWILKMPHALLGLVTGLLPTILLSLLMFLLPIIIRVFARISGEISAVGVEKWTQNAYFAFLMVNGFLVTA
LASSATATITEIIDKPTSAMSILANKLPLSSNFYISYLVLQGFSIAGGSLFQVVGLFLYYILGTLFDNTVRKKWNRFSGL
GTVAWGTVFPIFTQLASITLAYSIISPLILVFAFASFFLVYVAYAHNITYCFVEGPDAFGSHYPRALFQTFCGIYLGEIV
LLGIVVVGKGWGPIVIQVIVLLATIFAHVHLNLAFDHLLDVVPLDAMRAVDGVSSTASYTGPSEYESKVLNKKKRRANFE
KELLKEQEEESKLKADVKAQMESDYDQEEAIDTTSVVPLLADRDFKTTESNNPIVRFIRPDVFLNFRYVKRILPATYNVE
PKIVDNKHAYDAPAISAKCPGVWFPADPMGLSEIEIEQLSPIVDISTKNATFNEKGKIVFLGKPPN