TCDB is operated by the Saier Lab Bioinformatics Group
>YP_009725255.1 ORF10 protein [Severe acute respiratory syndrome coronavirus 2]
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT