TCDB is operated by the Saier Lab Bioinformatics Group
>XP_008873677.1 hypothetical protein H310_09397 [Aphanomyces invadans]
MLQGDEESAPLVSSQTRADGNPALLDGVNGDSQVDAPSPTFAEPVVVVDSNTTTFQQHPTSAAFVGAGIVEMEDDTTYFG
FIEPSVASPQPVDVESDEVLSSHDMGHVMTVQCAVETPAAESVPSAVVDVEEDATAGFLGAPVEASNPPAVALQVNGNRP
PTRIAHSHTASETTHDSKLRIAKFSTMPTMQKSKTFRFTPRPKSADTSRRGELQRFLSTPFHDYGDYGSTSTSSIPSTSH
PMLHADKSPSGAPTKQASTRKAAKNGGRRVARDRGMDDTKWDFVLVFPNPEFEKEKKDKKIKYPFIPTMNDMLTRLRQAG
LDTQLSKSTNLDVNTPKDQYIPPFVYCKLSASMERLKEEAARVHMSIGLVENKLERMAKQGEVRFHIENPEDRAAEIKRQ
GHEPLPPEKVSKVERRPYKKIQFEVGRELDVFNTFDICELENMDLEEAKSPSSAAASTKKPPSQSHLSAIFAMFKRFRYN
PYQYIHMTYTPQQNVQNLYGTPLFCSIKRIRLIESIVRSVTGAGLDLDMLVQFGAISAFYPMHDDEYCRDIQSTWSTSLW
LTHQPIEATREYFGGQAALYLAYVAHITRWLLFPSIFSISLFFASERYLVWVFGFVMVFWATLFLKMWKRKLAVLGMKWG
LTDFHAQDHDRPEYDESINRHMPSAHFGSMIFFRRVFCFMVTVVFLVAVLATKAGLFYVRWVSKAAPERFDFHVPFLDHD
TISLSYAGQLKIVAVLNVLAIFFWSTLFARINGFLTDIEVHHTEMSAQQSFILKGVIFELVNNFAGIIYIAFVKPHLEGI
DGNFAGPDVEAVEELSEYMLYIYGCQLLFHILLHVITPWIRHLCCLAKLPRTTKKVVANRARLQTITSFDDKSVARDVEA
VPIAQPKLLPVEVQHNLQEYGWKGLFQDYIAMIMQFGYATFFVVSCPYLPLMAFLYNLVSIRAHSISLVTMYRRLVPRSA
QHIRLWAAFLEVFCVLAVVTNSWSVVAKAEMASRTLEYLHVGNEYYVLVRSVCMGGLVLALYSVGKVLGFFINDIPTRVQ
IQLERQEYYISKVLHLGYQWDKTMHSILYAKSQEELEAEEGYGWDFAIVFPNPEVRRPPKLHPLTGKVEEVASMRDMILK
LHKAGLQVQFFESTAKVSSFIPSMVLCKIRASEQRLEAEAHRVKLPLLLNPDEMANQAMQGAIATAWQRVRKHVQAIEAE
MNSNSLDSLLQEIKLLTEKSDVMDMSESDVTWDILLTQLYLVLGDFIKQDSDIKAKYKELGVDPQLHSSMIKLSTLSEEL
IENLIIHDDEEETLVDLLLNAPRLLDDISAGLQQAGKDIGVQISLLPILIPSLAKRRKENSPMLPEHDLQKMMETLSQGY
VKMIPLLTKMGHLLALTLPLPDLRAIDALLEKRDVAGLHAMGEPNIWLRTELHLIHLMIQDNTLELPHLRQRSHTIDKSL
TIAASVQLWIDSVIANPMIDISPFYLQNPDPKYKGLSNKFRYGPYENIYMAYQDKRELQHWYHKKMSLHGPMQLFSSTER
LTLIESIITNNEVGAGLHLDKLILSGAIKGYFPLHDDHMKADLWKKWKWSLHQPIEEIRSYFGVKIGLYFAYLGHYTTWL
MLSAVVGGGVFATQTLQKRYFPPEIAEGFNWVKVLAVPIYGVFMVIWATLFLKYWIRKQWVFAMRWGMTDFHEEEQVRPQ
FQGSLMRDPVTGARMRYFSDKQRRWRLMFSWFVLAILICIVLMCVAGIFMLRYAFKHSVLLEVPYFGNIGTQCASLANVA
QIFMMSQVYNYVCNWLNDFENHRTDSDYENHFVAKAIVFQFVNNFALLFYVAFLKKIFEGECVDNNCMTELAVSLTYVYA
SQLVIGNCQEVIMPLFWANVEYFRHEWVKKTDDHEVVSAVETQFFMPEYGWAGTFWDYLEMIIQFGYSTFFVLACPLAPV
FSFCNNIFEIRIDGSKISKFCRRPRPSGASTIGHWVKVLDVFGIITIVTNAWIIVTTSKFGDLILLMWPKFDQYFSQIGL
FFTLTALLLGVKGLINSFIPDMPRHVRAQLKRQKFVVSKILSTHDTTD