TCDB is operated by the Saier Lab Bioinformatics Group

9.B.412.  The Ccercozoan Amoeba Octotrico Peptide Repeat (CAOPR) Family 

The cercozoan amoeba Paulinella chromatophora contains photosynthetic organelles-termed chromatophores, that evolved from a cyanobacterium approximately 100 million years ago, independently from plastids in plants and algae. Despite the more recent origin of the chromatophore, it shows tight integration into the host cell. It imports hundreds of nucleus-encoded proteins, and diverse metabolites are continuously exchanged across the two chromatophore envelope membranes. However, the limited set of chromatophore-encoded solute transporters appears insufficient for supporting metabolic connectivity or protein import. Furthermore, chromatophore-localized biosynthetic pathways as well as multiprotein complexes, include proteins of dual genetic origin, suggest that mechanisms evolved that coordinate gene expression levels between chromatophore and nucleus. Thus, similar to the situation in mitochondria and plastids, nuclear factors in P. chromatophora evolved that control metabolite exchange and gene expression in the chromatophore. Oberleitner et al. 2020 showed that nucleus-encoded transporters are not inserted into the chromatophore inner envelope membrane. Despite the apparent maintenance of its barrier function, canonical metabolite transporters are missing in this membrane, but there are several expanded groups of short chromatophore-targeted orphan proteins. Members of one of these groups are characterized by a single transmembrane helix, and others contain amphipathic helices. Possibly these proteins are involved in modulating membrane permeability. If so, the mechanism generating metabolic connectivity of the chromatophore fundamentally differs from the one for mitochondria and plastids, but likely rather resembles the mechanism in various bacterial endosymbionts in plants and insects. An expanded family of chromatophore-targeted helical repeat proteins show similar domain architectures as known organelle-targeted expression regulators of the octotrico peptide repeat type in algae and plants. Possibly, these chromatophore-targeted proteins evolved convergently to plastid-targeted expression regulators and are involved in gene expression control in the chromatophore (Oberleitner et al. 2020).

Here we list the sequences of some of these proteins in four of these groups:


Group 1

>scaffold29584-size464|m.137513
MVFAPADIPLWTIPISRTLQIVGLTTLMVGSGWIAGRVQSYKAAEKHFREKEKSRAS

>scaffold49054-size266|m.178992
MGIDFHGPELISRTVAGAGCAYGMYWLYSRKDQYTAEEQEFYSVSSFFKNKFKLPFSWPP
WAGWFKGKDV


Group 2

>scaffold21477-size653|m.115224
MGTHAGRGGQPVICLETGRVFKSVSAAASELGIKPQAIQFALRTPGRKCKGFTWERVKES
LCADLEGESV

>scaffold16589-size840|m.99155
IIRLFWAAFVSMVWELQGGMGGWSRIARPVLCVETGEVYKSITAAARATNASPGNLQKAI
EMGWKSKGFTWVYQDAPASTEAAAAAASS


Group 3

>scaffold28115-size491|m.133819
MVVSRGDPCLEPGCIGTLQGIPRSSILGCATCLKTFTFNEAEVIDRLFIQPKKKPVKVIE
GLVDPESFILTGI

>scaffold23696-size589|m.121764
SDNPAFLYSRMAVGDPTKMVSEFFSTSGDKCLDSTCTGTYRCVNPVYSKKLGEHDFRVQC
DSCRKFGNNCSRNPV


Group 4

>scaffold24369-size571|m.123655
SDNPAFLLAMSLYDPILPDDFSCPKCGKPADAVIQMQCGRCQTLFPINPKYDRNLAAPAP
VAAVGKKKRFGLF

>scaffold22321-size627|m.117732
MYALPLSMLSAFSDMFKCPKCGVKPRIKTSISCDKCSCPFPNNIAAVSDKIAEPGTDVIG
NPLHNPRVY

When BLASTED against the NCBI database, they bring up either no hits (groups 1,3 and 4), or proteins with poor scores (i.e., e-4) (proteins in group 2).  One of the latter will be listed in the proteins of this family, but they may or may not be functionally related.


 

References associated with 9.B.412 family:

Oberleitner, L., G. Poschmann, L. Macorano, S. Schott-Verdugo, H. Gohlke, K. Stühler, and E.C.M. Nowack. (2020). The Puzzle of Metabolite Exchange and Identification of Putative Octotrico Peptide Repeat Expression Regulators in the Nascent Photosynthetic Organelles of. Front Microbiol 11: 607182. 33329499